Iright
BRAND / VENDOR: Proteintech

Proteintech, 28475-1-AP, IL-1 alpha Polyclonal antibody

CATALOG NUMBER: 28475-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IL-1 alpha (28475-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1 alpha in WB, ELISA applications with reactivity to human samples 28475-1-AP targets IL-1 alpha in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PMA, LPS and Brefeldin A treated THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Interleukin-1α (IL-1 alpha) is a protein that plays a crucial role in the regulation of a number of key cellular processes. IL-1 Alpha is a cytokine and a potent mediator of body's response to inflammation, microbial invasion, tissue injury and immunological response. In addition, recent studies suggest that IL-1 Alpha also has a role in wound healing, rheumatoid arthritis, Alzheimer's disease and tumor growth. IL-1 Alpha functions as an alarmin during the process of sterile inflammation. It serves as a signal from dying cells to potentiate the inflammatory response, increasing the expression of other secreted factors like IL-6 and IL-8. IL-1 Alpha was found to affect the cell cycle of osteosarcoma cell to reduce cell growth. IL-1 Alpha is initially translated as approximately 30-kD polypeptides that are processed to approximately 17.5-kD polypeptides prior to, or during, release from macrophages. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29587 Product name: Recombinant human IL-1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-271 aa of BC013142 Sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA Predict reactive species Full Name: interleukin 1, alpha Calculated Molecular Weight: 271 aa, 31 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC013142 Gene Symbol: IL-1 alpha Gene ID (NCBI): 3552 RRID: AB_2918169 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01583 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924