Proteintech, 28476-1-AP, Calpain 3 Polyclonal antibody

Size: 20ul / 150ul The Calpain 3 (28476-1-AP) by Proteintech is a Polyclonal antibody targeting Calpain 3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 28476-1-AP targets Calpain 3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Calpain 3 (CAPN3), a major intracellular protease, is a muscle-specific member of the calpain large subunit family that specifically binds to titin. CAPN3 plays a role in the dysferlin protein complex and that disruption of CAPN3 function may affect muscle membrane repair and remodeling. CAPN3 has some isoforms with MW of 94, 84, 93, 36, 18 kDa. CAPN3 autolysis generates a small N-terminal fragment of 34 kDa and a large C-terminal fragment whose size ranges from 55 to 60 kDa during self-processing (PMID: 9794799, 14645524). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29454 Product name: Recombinant human CAPN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 488-666 aa of BC146672 Sequence: NRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDM Predict reactive species Full Name: calpain 3, (p94) Observed Molecular Weight: 90-105 kDa, 55-60 kDa GenBank Accession Number: BC146672 Gene Symbol: CAPN3 Gene ID (NCBI): 825 RRID: AB_2881150 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20807 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.