Product Description
Size: 20ul / 150ul
The GAT1 (28488-1-AP) by Proteintech is a Polyclonal antibody targeting GAT1 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples
28488-1-AP targets GAT1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse, Rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue
Positive IHC detected in: mouse cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: Human, Mouse, Rat
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag29712 Product name: Recombinant human SLC6A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC033904 Sequence: MATNGSKVADGQISTEVSEAPVANDKPKTLVVKVQKKAADLPDRDTWKGRFD Predict reactive species
Full Name: solute carrier family 6 (neurotransmitter transporter, GABA), member 1
Calculated Molecular Weight: 67 kDa
Observed Molecular Weight: 42 kDa
GenBank Accession Number: BC033904
Gene Symbol: GABA Transporter 1/GAT1
Gene ID (NCBI): 6529
RRID: AB_2881154
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P30531
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924