Proteintech, 28490-1-AP, DDIT4L Polyclonal antibody

Size: 20ul / 150ul The DDIT4L (28490-1-AP) by Proteintech is a Polyclonal antibody targeting DDIT4L in WB, IHC, ELISA applications with reactivity to human, mouse samples 28490-1-AP targets DDIT4L in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse ovary tissue Positive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DNA-damage-inducible transcript 4-like protein(DDIT4L), encoded by the stress responsive gene REDD2, is a negative regulator of mTOR signaling, and expressed predominantly in skeletal muscle. It regulates the TOR signaling pathway upstream of the TSC1-TSC2 complex and downstream of AKT1. Also, DDIT4L involves in oxidized low-density lipoprotein-induced macrophage death sensitivity. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29616 Product name: Recombinant human DDIT4L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC013592 Sequence: MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTE Predict reactive species Full Name: DNA-damage-inducible transcript 4-like Calculated Molecular Weight: 193 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC013592 Gene Symbol: DDIT4L Gene ID (NCBI): 115265 RRID: AB_3669660 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96D03 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.