Proteintech, 28511-1-AP, Piezo1 (extracellular domain) Polyclonal antibody

Size: 20ul / 150ul The Piezo1 (extracellular domain) (28511-1-AP) by Proteintech is a Polyclonal antibody targeting Piezo1 (extracellular domain) in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 28511-1-AP targets Piezo1 (extracellular domain) in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Hepa1-6 cells, HepG2 cells, hTERT-RPE1 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Mechanotransduction, the conversion of mechanical force into biological signals, is a fundamental physiologic process of mammalian cells which influences many critical processes including embryonic development, tactile, pain, and auditory sensation, regulation of vascular tone, flow sensing in the kidney, and muscle and tendon stretch. FAM38A, also known as PIEZO1, has recently been identified as a mechanotransduction protein that gets involved in mechanosensation and stretch-activated cation channel activation. Fam38A also plays a key role in epithelial cell adhesion by maintaining integrin activation through R-Ras recruitment to the ER. Mutations in gene encoding PIEZO1 are associated with hereditary xerocytosis. Piezo1 also regulates extrusion to maintain homeostatic epithelial cell numbers. This antibody was raised against the extracellular domain of human Piezo1. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29858 Product name: Recombinant human FAM38A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 108-294 aa of BC008073 Sequence: YEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDK Predict reactive species Full Name: family with sequence similarity 38, member A Calculated Molecular Weight: 286 kDa Observed Molecular Weight: 280-300 kDa GenBank Accession Number: BC008073 Gene Symbol: Piezo1/FAM38A Gene ID (NCBI): 9780 RRID: AB_2881161 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92508 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.