Iright
BRAND / VENDOR: Proteintech

Proteintech, 28524-1-AP, THSD7A Polyclonal antibody

CATALOG NUMBER: 28524-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The THSD7A (28524-1-AP) by Proteintech is a Polyclonal antibody targeting THSD7A in WB, ELISA applications with reactivity to Human, Mouse samples 28524-1-AP targets THSD7A in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:600-1:2000 Background Information Thrombospondin type-1 domain-containing protein 7A (THSD7A) is a membrane-associated N-glycoprotein with a molecular weight of 250 kDa, which can be cleaved to release a 210-kDa soluble form (PMID: 22194972; 27214550). THSD7A has a role in angiogenesis. It mediates endothelial cell migration and tube formation (PMID: 2002048). THSD7A has been identified as a second autoantigen involved in adult idiopathic membranous nephropathy in addition to PLA2R1 (PMID: 25394321). Specification Tested Reactivity: Human, Mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29107 Product name: Recombinant human THSD7A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1305-1485 aa of NM_015204 Sequence: TGKMIRRRTVTQPFQGDGRPCPSLMDQSKPCPVKPCYRWQYGQWSPCQVQEAQCGEGTRTRNISCVVSDGSADDFSKVVDEEFCADIELIIDGNKNMVLEESCSQPCPGDCYLKDWSSWSLCQLTCVNGEDLGFGGIQVRSRPVIIQELENQHLCPEQMLETKSCYDGQCYEYKWMASAWK Predict reactive species Full Name: thrombospondin, type I, domain containing 7A Calculated Molecular Weight: 185 kDa Observed Molecular Weight: 240-250 kDa GenBank Accession Number: NM_015204 Gene Symbol: THSD7A Gene ID (NCBI): 221981 RRID: AB_2918172 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPZ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924