Proteintech, 28530-1-AP, IGF1 Polyclonal antibody

Size: 20ul / 150ul The IGF1 (28530-1-AP) by Proteintech is a Polyclonal antibody targeting IGF1 in IHC, ELISA applications with reactivity to Human, mouse samples 28530-1-AP targets IGF1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive IHC detected in: human liver tissue, mouse kidney tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information IGF1, also named as IBP1, MGF, IGF-IA, and Somatomedin-C, belongs to the INS family. IGF1 is structurally and functionally related to INS but has a much higher growth-promoting activity. Altered expression or mutation of IGF-1 is associated with several human disorders, including type I diabetes and various forms of cancer. Defects in IGF1 are the cause of INS-like growth factor I deficiency (IGF1 deficiency) which is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness, and mental retardation. Specification Tested Reactivity: Human, mouse Cited Reactivity: human, mouse, rat, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29197 Product name: Recombinant human IGF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 49-118 aa of NM_001111285.2 Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKS Predict reactive species Full Name: insulin-like growth factor 1 (somatomedin C) Calculated Molecular Weight: 22 kDa GenBank Accession Number: NM_001111285.2 Gene Symbol: IGF1 Gene ID (NCBI): 3479 RRID: AB_2881164 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05019 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.