Iright
BRAND / VENDOR: Proteintech

Proteintech, 28569-1-AP, HCFC1 Polyclonal antibody

CATALOG NUMBER: 28569-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HCFC1 (28569-1-AP) by Proteintech is a Polyclonal antibody targeting HCFC1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 28569-1-AP targets HCFC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, NIH/3T3 cells, PC-12 cells, C2C12 cells, C6 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse liver tissue, human lung cancer tissue, human urothelial carcinoma tissue, mouse cerebellum tissue, mouse lung tissue, mouse skin tissue, rat cerebellum tissue, rat lung tissue, rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information HCFC1 (also known as HCF-1) was discovered in studies of herpes simplex virus (HSV) transcription. This nuclear coactivator is proteolytically cleaved at one of the six possible sites, resulting in the creation of an N-terminal chain and the corresponding C-terminal chain. The final form of this protein consists of noncovalently bound N- and C-terminal chains. The protein is involved in the control of the cell cycle and transcriptional regulation during herpes simplex virus infection. HCFC1 is a large protein of ∼300 kDa and is proteolytically processed into N- and C-terminal fragments of ∼150 kDa each.(PMID: 21295698 ) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29663 Product name: Recombinant human HCFC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1018-1174 aa of NM_005334 Sequence: CETHETGTTNTATTTVVANLGGHPQPTQVQFVCDRQEAAASLVTSTVGQQNGSVVRVCSNPPCETHETGTTNTATTATSNMAGQHGCSNPPCETHETGTTNTATTAMSSVGANHQRDARRACAAGTPAVIRISVATGALEAAQGSKSQCQTRQTSAT Predict reactive species Full Name: host cell factor C1 (VP16-accessory protein) Calculated Molecular Weight: 209 kDa Observed Molecular Weight: 300 kDa, 100-150 kDa GenBank Accession Number: NM_005334 Gene Symbol: HCFC1 Gene ID (NCBI): 3054 RRID: AB_3086066 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51610 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924