Product Description
Size: 20ul / 150ul
The ZBTB8OS (28608-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB8OS in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples
28608-1-AP targets ZBTB8OS in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse kidney tissue, rat kidney tissue
Positive IHC detected in: mouse kidney tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: Human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag29853 Product name: Recombinant human ZBTB8OS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-136 aa of BC058843 Sequence: AQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQTVEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPRVGRRIFIVQAPSGNRSQSNNIFSNAGL Predict reactive species
Full Name: zinc finger and BTB domain containing 8 opposite strand
Observed Molecular Weight: 19 kDa
GenBank Accession Number: BC058843
Gene Symbol: ZBTB8OS
Gene ID (NCBI): 339487
RRID: AB_2881180
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8IWT0
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924