Iright
BRAND / VENDOR: Proteintech

Proteintech, 28622-1-AP, BCAT1 Polyclonal antibody

CATALOG NUMBER: 28622-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BCAT1 (28622-1-AP) by Proteintech is a Polyclonal antibody targeting BCAT1 in WB, IHC, ELISA applications with reactivity to Human, rat samples 28622-1-AP targets BCAT1 in WB, IHC, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: C6 cells, Jurkat cells Positive IHC detected in: human liver cancer tissue, human lung cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BCAT1, also named as branched-chain amino acid trasaminase1, is a cytosolic enzyme responsible for the reversible transamination of leucine, isoleucine and valine that catalyzes the transformation of branched-chain L-amino acids (BCAA) into branched-chain a-ketoacids (BCKA), thereby providing macromolecule precursors. It has been reported that BCAT1 is associated with tumor growth and disease progression (PMID:29255149). Specification Tested Reactivity: Human, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28998 Product name: Recombinant human BCAT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-115 aa of BC033864 Sequence: MDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLN Predict reactive species Full Name: branched chain aminotransferase 1, cytosolic Calculated Molecular Weight: 320 aa, 36 kDa Observed Molecular Weight: 43-48 kDa GenBank Accession Number: BC033864 Gene Symbol: BCAT1 Gene ID (NCBI): 586 RRID: AB_2881183 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P54687 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924