Proteintech, 28627-1-AP, CLEC12A Polyclonal antibody

Size: 20ul / 150ul The CLEC12A (28627-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC12A in WB, IF/ICC, ELISA applications with reactivity to Human samples 28627-1-AP targets CLEC12A in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: U-937 cells, human peripheral blood leukocyte Positive IF/ICC detected in: U-937 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CLEC12A, also known as CD371, MICL, DCAL-2 or CLL-1, is a type II transmembrane glycoprotein and a member of the C-type lectin superfamily (PMID: 30401586). This protein, which contains a single C-type lectin-like domain and a cytoplasmic immunoreceptor tyrosine-based inhibitory motif (ITIM), is related to LOX-1 and Dectin-1 and is variably spliced and highly N-glycosylated (PMID: 14739280). Its ITIM sequence recruits the tyrosine phosphatases SHP-1 and SHP-2 to negatively regulate Syk signaling. In humans, CLEC12A is mainly expressed on myeloid cells, being found on monocytes, granulocytes, macrophages and DC subsets, and at lower levels on CD4+ T cells (PMID: 32477350). The observed molecular weight of CLEC12A is between 40 and 75 kDa, which is much higher than the predicted molecular weight due to glycosylation (PMID: 14739280). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27864 Product name: Recombinant human CLEC12A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-213 aa of BC063424 Sequence: MSEEVTYADLQFQNSSEMEKIPEIGKFGEKAPPAPSHVWRPAALFLTLLCLLLLIGLGVLASMFHVTLKIEMKKMNKLQNISEELQRNISLQLMSNMNISNKIRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSA Predict reactive species Full Name: C-type lectin domain family 12, member A Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 55-75 kDa GenBank Accession Number: BC063424 Gene Symbol: CLEC12A Gene ID (NCBI): 160364 RRID: AB_3086071 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5QGZ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.