Proteintech, 28630-1-AP, TCTN1 Polyclonal antibody

Size: 20ul / 150ul The TCTN1 (28630-1-AP) by Proteintech is a Polyclonal antibody targeting TCTN1 in WB, ELISA applications with reactivity to Human, mouse, rat samples 28630-1-AP targets TCTN1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: DU 145 cells, mouse brain tissue, HCT 116 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30064 Product name: Recombinant human TCTN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-306 aa of BC062611 Sequence: EVPDENNFDTLMKTSDGFTLNAESYVSFTTKLDIPTAAKYEYGVPLQTSDSFLRFPSSLTSSLCTDNNPAAFLVNQAVKCTRKINLEQCEEIEALSMAFYSSPEILRVPDSRKKVPITVQSIVIQSLNKTLTRREDTDV Predict reactive species Full Name: tectonic family member 1 Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 60-75 kDa GenBank Accession Number: BC062611 Gene Symbol: TCTN1 Gene ID (NCBI): 79600 RRID: AB_2918185 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2MV58 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.