Iright
BRAND / VENDOR: Proteintech

Proteintech, 28652-1-AP, CCDC60 Polyclonal antibody

CATALOG NUMBER: 28652-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CCDC60 (28652-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC60 in WB, ELISA applications with reactivity to Human samples 28652-1-AP targets CCDC60 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Coiled-coil domain containing 60 (CCDC60) is a member of the CCDC family, which participates in the progression of many types of cancer. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28109 Product name: Recombinant human CCDC60 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-238 aa of BC040553 Sequence: MTKVPATKKLQSSPNSGAVRPFYASENLRQVPDKPMKSIKYMDKEIINLKKDLIRSRFLIQSVKIGRGYFAILREETAKKKKQQQLQKLKEEERNKFQPAEKISEIHYGDTLLSTYDDEKLKTLGARVTRRPFTPIHSCIISPSLTEAHVEPLFRQLCALHWLLEALTIDHTHHTMKPVITCWNPKDPGGSKSTIKKINKDKSMGQKWEHFITAPKTKEFKIPTMRVTNRKPSRRGST Predict reactive species Full Name: coiled-coil domain containing 60 Calculated Molecular Weight: 550 aa, 63 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC040553 Gene Symbol: CCDC60 Gene ID (NCBI): 160777 RRID: AB_3086075 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924