Proteintech, 28652-1-AP, CCDC60 Polyclonal antibody

Size: 20ul / 150ul The CCDC60 (28652-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC60 in WB, ELISA applications with reactivity to Human samples 28652-1-AP targets CCDC60 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Coiled-coil domain containing 60 (CCDC60) is a member of the CCDC family, which participates in the progression of many types of cancer. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28109 Product name: Recombinant human CCDC60 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-238 aa of BC040553 Sequence: MTKVPATKKLQSSPNSGAVRPFYASENLRQVPDKPMKSIKYMDKEIINLKKDLIRSRFLIQSVKIGRGYFAILREETAKKKKQQQLQKLKEEERNKFQPAEKISEIHYGDTLLSTYDDEKLKTLGARVTRRPFTPIHSCIISPSLTEAHVEPLFRQLCALHWLLEALTIDHTHHTMKPVITCWNPKDPGGSKSTIKKINKDKSMGQKWEHFITAPKTKEFKIPTMRVTNRKPSRRGST Predict reactive species Full Name: coiled-coil domain containing 60 Calculated Molecular Weight: 550 aa, 63 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC040553 Gene Symbol: CCDC60 Gene ID (NCBI): 160777 RRID: AB_3086075 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.