Proteintech, 28671-1-AP, RFC5 Polyclonal antibody

Size: 20ul / 150ul The RFC5 (28671-1-AP) by Proteintech is a Polyclonal antibody targeting RFC5 in WB, IF/ICC, ELISA applications with reactivity to human samples 28671-1-AP targets RFC5 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, U-251 cells, HEK-293T cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Replication factor C subunit 5 (RFC5), also known as activator 1, can recruit proliferating cell nuclear antigen(PCNA) onto the DNA polymerase S-phase checkpoint complex. In eukaryotes, RFC5 is involved in repairing mismatches, DNA double helix damage, nucleotide excision, and regulating the cell cycle(PMID: 30210909). RFC5 is significantly upregulated in cancer tissues or cells, and its expression is elevated with the cancer progression(PMID: 30214556). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29236 Product name: Recombinant human RFC5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 219-341 aa of BC001866 Sequence: ILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA Predict reactive species Full Name: replication factor C (activator 1) 5, 36.5kDa Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC001866 Gene Symbol: RFC5 Gene ID (NCBI): 5985 RRID: AB_2918189 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40937 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.