Iright
BRAND / VENDOR: Proteintech

Proteintech, 28682-1-AP, TRABD2B Polyclonal antibody

CATALOG NUMBER: 28682-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TRABD2B (28682-1-AP) by Proteintech is a Polyclonal antibody targeting TRABD2B in WB, ELISA applications with reactivity to Human samples 28682-1-AP targets TRABD2B in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: DU 145 cells, HT-29 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30248 Product name: Recombinant human TRABD2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 345-494 aa of NM_001194986 Sequence: AGLEVDHTPAGQAIHSPAPQSPAPSPEGTSTSPAPVTPAAAVPEAPSVTPTAPPEDEDPALSPHLLLPDSLSQLEEFGRQRKWHKRQSTHQRPRQFNDLWVRIEDSTTASPPPLPLQPTHSSGTAKPPFQLSDQLQQQDPPGPASSSAPT Predict reactive species Full Name: UPF0632 protein A Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 65-79 kDa GenBank Accession Number: NM_001194986 Gene Symbol: TRABD2B/TIKI2 Gene ID (NCBI): 388630 RRID: AB_2881193 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NFA1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924