Iright
BRAND / VENDOR: Proteintech

Proteintech, 28693-1-AP, SEC62 Polyclonal antibody

CATALOG NUMBER: 28693-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SEC62 (28693-1-AP) by Proteintech is a Polyclonal antibody targeting SEC62 in WB, IF/ICC, ELISA applications with reactivity to human samples 28693-1-AP targets SEC62 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, SW480 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SEC62 is a integral endoplasmic reticulum (ER) membrane protein. SEC62 and SEC63 form a dimeric complex and play a central role in translocation of nascent and newly synthesized precursor polypeptides into the ER. SEC62 is associated with poor prognosis in a variety of tumors, such as prostate cancer, hepatocellular cancer, breast cancer , melanoma, colorectal cancer (PMID: 36262254). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29932 Product name: Recombinant human SEC62 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of NM_003262 Sequence: MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNE Predict reactive species Full Name: SEC62 homolog (S. cerevisiae) Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: NM_003262 Gene Symbol: SEC62 Gene ID (NCBI): 7095 RRID: AB_3086078 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99442 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924