Iright
BRAND / VENDOR: Proteintech

Proteintech, 28694-1-AP, SP7 Polyclonal antibody

CATALOG NUMBER: 28694-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SP7 (28694-1-AP) by Proteintech is a Polyclonal antibody targeting SP7 in WB, ELISA applications with reactivity to human samples 28694-1-AP targets SP7 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Saos-2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Sp7 is identified in several tissues, including bone, tooth, brain, and the reproductive tract (PMID: 11792318, 33135214, 36881265). In bone, Sp7 is expressed at multiple stages throughout the mesenchymal bone lineage and plays different roles in different osteocytes (PMID: 36881265). SP7 regulates osteoblast differentiation and bone formation through osteoblast target genes by recognizing AT-rich region. In osteocytes, SP7 regulates osteocyte maturation and intracortical remodeling through osteocyte target genes by recognizing TGA(G/T) TCA motif. SP7 also regulates chondrocyte differentiation and endochondral ossification (36881265). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29889 Product name: Recombinant human SP7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-179 aa of NM_152860 Sequence: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTMGDAYPAPFTSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQ Predict reactive species Full Name: Sp7 transcription factor Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_152860 Gene Symbol: SP7 Gene ID (NCBI): 121340 RRID: AB_3669667 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDD2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924