Iright
BRAND / VENDOR: Proteintech

Proteintech, 28715-1-AP, SFRS6 Polyclonal antibody

CATALOG NUMBER: 28715-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SFRS6 (28715-1-AP) by Proteintech is a Polyclonal antibody targeting SFRS6 in WB, ELISA applications with reactivity to Human samples 28715-1-AP targets SFRS6 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28912 Product name: Recombinant human SFRS6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-344 aa of BC006832 Sequence: EDKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSSRD Predict reactive species Full Name: splicing factor, arginine/serine-rich 6 Calculated Molecular Weight: 344 aa, 40 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC006832 Gene Symbol: SFRS6 Gene ID (NCBI): 6431 RRID: AB_2918194 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13247 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924