Proteintech, 28722-1-AP, IFN-gamma Polyclonal antibody

Size: 20ul / 150ul The IFN-gamma (28722-1-AP) by Proteintech is a Polyclonal antibody targeting IFN-gamma in WB, ELISA applications with reactivity to human samples 28722-1-AP targets IFN-gamma in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PMA, Ionomycin and Brefeldin A treated NK-92 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Interferon gamma (IFNG) is a soluble cytokine that is the only member of the type II class of interferons. It is secreted by Th1 cells, cytotoxic T cells and NK cells. The cytokine is associated with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. It plays crucial roles in pathogen clearance. Aberrant IFNG expression is associated with a number of autoinflammatory and autoimmune diseases. It has been identified in many studies as a biomarker for pleural tuberculosis (TB). Mutations in this gene are associated with aplastic anemia. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30371 Product name: Recombinant human IFNG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 85-161 aa of BC070256 Sequence: DDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG Predict reactive species Full Name: IFN gamma Calculated Molecular Weight: 166 aa, 19 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC070256 Gene Symbol: IFNG Gene ID (NCBI): 3458 ENSEMBL Gene ID: ENSG00000111537 RRID: AB_3086082 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01579 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.