Proteintech, 28724-1-AP, KCC2/SLC12A5 Polyclonal antibody

Size: 20ul / 150ul The KCC2/SLC12A5 (28724-1-AP) by Proteintech is a Polyclonal antibody targeting KCC2/SLC12A5 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Mouse, Rat samples 28724-1-AP targets KCC2/SLC12A5 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information KCC2, encoded by SLC12A5, is a neuron-specific K+-Cl- cotransporter that is essential for Cl- homeostasis and inhibitory synaptic transmission in brain. KCC2 is expressed at high levels in neurons throughout the nervous system. KCC2 deletion caused animal death. Alterations of KCC2 have been linked to neuropathic pain, temporal lobe epilepsy, and other diseases. Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30203 Product name: Recombinant human SLC12A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 915-1043 aa of BC132670 Sequence: ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLN Predict reactive species Full Name: solute carrier family 12 (potassium-chloride transporter), member 5 Observed Molecular Weight: 130-150 kDa GenBank Accession Number: BC132670 Gene Symbol: KCC2 Gene ID (NCBI): 57468 RRID: AB_2918195 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2X9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.