Iright
BRAND / VENDOR: Proteintech

Proteintech, 28725-1-AP, TRIM58 Polyclonal antibody

CATALOG NUMBER: 28725-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TRIM58 (28725-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM58 in WB, ELISA applications with reactivity to human samples 28725-1-AP targets TRIM58 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TRIM58 (Tripartite motif-containing protein 58) is an E3 ubiquitin ligase induced during late erythropoiesis. It can directly bind and ubiquitinate the intermediate chain of the microtubule motor dynein (DYNC1LI1/DYNC1LI2), stimulating the degradation of the dynein holoprotein complex. May participate in the erythroblast enucleation process through regulation of nuclear polarization (PMID: 25241935). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30014 Product name: Recombinant human TRIM58 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 120-330 aa of NM_015431 Sequence: AGPEHRTHRTAPLQEAAGSYQVKLQMALELMRKELEDALTQEANVGKKTVIWKEKVEMQRQRFRLEFEKHRGFLAQEEQRQLRRLEAEERATLQRLRESKSRLVQQSKALKELADELQERCQRPALGLLEGVRGVLSRSKAVTRLEAENIPMELKTACCIPGRRELLRKFQVDVKLDPATAHPSLLLTADLRSVQDGEPWRDVPNNPERFD Predict reactive species Full Name: tripartite motif-containing 58 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: NM_015431 Gene Symbol: TRIM58 Gene ID (NCBI): 25893 RRID: AB_3669668 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NG06 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924