Iright
BRAND / VENDOR: Proteintech

Proteintech, 28747-1-AP, MDMX/MDM4 Polyclonal antibody

CATALOG NUMBER: 28747-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MDMX/MDM4 (28747-1-AP) by Proteintech is a Polyclonal antibody targeting MDMX/MDM4 in WB, IHC, IP, ELISA applications with reactivity to human samples 28747-1-AP targets MDMX/MDM4 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A2780 cells, MCF-7 cells, MDA-MB-231 cells, U2OS cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human ovary tumor tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MDM4 is also named as MDMX. It inhibits the activity of the tumor suppressor p53 by primarily cooperating with the p53 feedback regulator MDM2. MDM4 resides mostly in the cytoplasm, but can be recruited to the nucleus by MDM2.(PMID:16511572). The predicted mass of the protein is 54 kDa, while the observed mass is 70-80 kDa, a difference which stated is probably due to phosphorylation or other posttranslational modification(PMID:9226370, 28097652). It can be ubiquitinated and degraded by MDM2(PMID:16163388). It has 5 isoforms produced by alternative splicing. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30456 Product name: Recombinant human MDM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 359-490 aa of BC067299 Sequence: VPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA Predict reactive species Full Name: Mdm4 p53 binding protein homolog (mouse) Calculated Molecular Weight: 490 aa, 55 kDa Observed Molecular Weight: 70-76 kDa GenBank Accession Number: BC067299 Gene Symbol: MDMX/MDM4 Gene ID (NCBI): 4194 RRID: AB_3086083 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15151 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924