Iright
BRAND / VENDOR: Proteintech

Proteintech, 28753-1-AP, TRPS1 Polyclonal antibody

CATALOG NUMBER: 28753-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TRPS1 (28753-1-AP) by Proteintech is a Polyclonal antibody targeting TRPS1 in WB, IHC, ELISA applications with reactivity to human samples 28753-1-AP targets TRPS1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:800-1:3200 Background Information TRPS1 is a zinc finger transcriptional repressor involved in the regulation of chondrocyte and perichondrium development, containing a GATA-type zinc finger through which it binds to DNA. with nine zinc-finger domains and two C-terminal Ikaros-like zinc fingers. Its reperssible function was dependent on the integrity of the Trps1 GATA-type zinc-finger domain and also required the C-terminal 119 amino acids of the protein, which harbor the two Ikaros-like zinc-finger domains Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30188 Product name: Recombinant human TRPS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1158-1281 aa of NM_014112 Sequence: SDNDIPLDLAIKHSRPGPTANGASKEKTKAPPNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE Predict reactive species Full Name: trichorhinophalangeal syndrome I Calculated Molecular Weight: 142 kDa Observed Molecular Weight: 142 kDa GenBank Accession Number: NM_014112 Gene Symbol: TRPS1 Gene ID (NCBI): 7227 RRID: AB_2881209 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924