Iright
BRAND / VENDOR: Proteintech

Proteintech, 28820-1-AP, WIPI2 Polyclonal antibody

CATALOG NUMBER: 28820-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The WIPI2 (28820-1-AP) by Proteintech is a Polyclonal antibody targeting WIPI2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 28820-1-AP targets WIPI2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, RAW 264.7 cells Positive IHC detected in: human heart tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information WIPI2, the mammalian homologue of the yeast ATG18 gene, plays a key role in autophagy. It binds the omegasome, a phosphatidylinositol 3-phosphate (PI3P) rich domain of the endoplasmic reticulum from which the mature autophagosome develops. Western blotting detected a 49 kDa WIPI2 band.(PMID: 30968111, PMID: 30403914) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30505 Product name: Recombinant human WIPI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 368-454 aa of BC004116 Sequence: ALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD Predict reactive species Full Name: WD repeat domain, phosphoinositide interacting 2 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC004116 Gene Symbol: WIPI2 Gene ID (NCBI): 26100 RRID: AB_2881218 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y4P8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924