Product Description
Size: 20ul / 150ul
The CORO2A (28883-1-AP) by Proteintech is a Polyclonal antibody targeting CORO2A in WB, IHC, ELISA applications with reactivity to Human, mouse samples
28883-1-AP targets CORO2A in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.
Tested Applications
Positive WB detected in: Jurkat cells, Raji cells
Positive IHC detected in: human skin cancer tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
CORO2A (Coronin 2A), also named as CLIPINB, is a member of the 'short' coronin subfamily containing a single WD40-repeat domain. It has been shown that the expression of CORO2A is up-regulated in human colon cancer. CORO2A can interact with MAPK14 and PRMT5. The calculated MW of CORO2A is 60 kDa, while 28883-1-AP antibody detects 48 kDa protein which is similar to the paper published. (PMID: 26373535)
Specification
Tested Reactivity: Human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag29696 Product name: Recombinant human CORO2A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 162-279 aa of BC000010 Sequence: LDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPRAGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYD Predict reactive species
Full Name: coronin, actin binding protein, 2A
Calculated Molecular Weight: 60 kDa
Observed Molecular Weight: 48 kDa
GenBank Accession Number: BC000010
Gene Symbol: CORO2A
Gene ID (NCBI): 7464
RRID: AB_2881227
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q92828
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924