Proteintech, 29023-1-AP, DKK2 Polyclonal antibody

Size: 20ul / 150ul The DKK2 (29023-1-AP) by Proteintech is a Polyclonal antibody targeting DKK2 in WB, ELISA applications with reactivity to Human, mouse, rat samples 29023-1-AP targets DKK2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30596 Product name: Recombinant human DKK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-183 aa of BC075078 Sequence: KLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPC Predict reactive species Full Name: dickkopf homolog 2 (Xenopus laevis) Calculated Molecular Weight: 259 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC075078 Gene Symbol: DKK2 Gene ID (NCBI): 27123 RRID: AB_3086095 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBU2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.