Proteintech, 29041-1-AP, CES1 Polyclonal antibody

Size: 20ul / 150ul The CES1 (29041-1-AP) by Proteintech is a Polyclonal antibody targeting CES1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, rat, mouse samples 29041-1-AP targets CES1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: THP-1 cells, rat liver tissue, hepG2 cells, Caco-2 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: C2C12 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Human carboxylesterase 1 (hCE1 or CES1) is a serine esterase that hydrolyzes a variety of endogenous and exogenous substrates. CES1 contributes to approximately 90% of hepatic hydrolytic activity in human livers (PMID: 27895113). Variation in CES1 has the ability to affect the metabolism of methylphenidate (PMID: 28087982). CES1 has 567 amino acids and a theoretical molecular mass of 62 kDa. Specification Tested Reactivity: Human, rat, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30534 Product name: Recombinant human CES1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 505-566 aa of BC012418 Sequence: NGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEHIEL Predict reactive species Full Name: carboxylesterase 1 (monocyte/macrophage serine esterase 1) Calculated Molecular Weight: 566 aa, 62 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC012418 Gene Symbol: CES1 Gene ID (NCBI): 1066 RRID: AB_3086096 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23141 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.