Iright
BRAND / VENDOR: Proteintech

Proteintech, 29042-1-AP, Integrin alpha 1 Polyclonal antibody

CATALOG NUMBER: 29042-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Integrin alpha 1 (29042-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin alpha 1 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, rat samples 29042-1-AP targets Integrin alpha 1 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, rat lung tissue Positive IHC detected in: human placenta tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Positive IF-Fro detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha-1 (ITGA1, CD49a) combines with the beta 1 subunit (ITGB1, CD29) to form a cell-surface receptor for collagen and laminin. This receptor is involved in cell-cell adhesion and may play a role in inflammation and fibrosis. Integrin alpha-1 is a transmembrane glycoprotein with an apparent molecular weight of 180-250 kDa, larger than the calculated molecular weight of 131 kDa (PMID: 2475259; 3257425; 11557277; 18840653). Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30613 Product name: Recombinant human Integrin alpha-1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 980-1141 aa of BC137121 Sequence: GNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSINSGKKMTTSTDHLKRGTILDCNTCKFATITCNLTSSDISQVNVSLILWKPTFIKSYFSSLNLTIRGELRSENASLVLSSSNQKRELAIQISKDGLPGRVP Predict reactive species Full Name: integrin, alpha 1 Calculated Molecular Weight: 1179 aa, 131 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: BC137121 Gene Symbol: Integrin alpha 1 Gene ID (NCBI): 3672 RRID: AB_2881238 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56199 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924