Proteintech, 29084-1-AP, G6PC Polyclonal antibody

Size: 20ul / 150ul The G6PC (29084-1-AP) by Proteintech is a Polyclonal antibody targeting G6PC in WB, IF-P, ELISA applications with reactivity to human, mouse samples 29084-1-AP targets G6PC in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells Positive IF-P detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Glucose-6-phosphatase-α (G6PC) is a key enzyme in glucose homeostasis that catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis. G6PC activity is restricted to the liver , the kidney cortex and the small intestine and confers on these three organs the capacity to release glucose into the systemic circulation (PMID: 21983240).The encoded enzyme is anchored to the ER by nine transmembrane helices with the amino (N)-terminus in the lumen and the carboxyl (C)-terminus in the cytoplasm (PMID: 15542400). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30614 Product name: Recombinant human G6PC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-121 aa of BC130478 Sequence: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM Predict reactive species Full Name: glucose-6-phosphatase, catalytic subunit Calculated Molecular Weight: 357 aa, 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC130478 Gene Symbol: G6PC Gene ID (NCBI): 2538 RRID: AB_3669673 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35575 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.