Iright
BRAND / VENDOR: Proteintech

Proteintech, 29115-1-AP, PTH1R Polyclonal antibody

CATALOG NUMBER: 29115-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PTH1R (29115-1-AP) by Proteintech is a Polyclonal antibody targeting PTH1R in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29115-1-AP targets PTH1R in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse kidney tissue, HepG2 cells, mouse liver tissue, rat kidney tissue, rat liver tissue Positive IHC detected in: human pancreas cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PTH1R is a receptor for parathyroid hormone and parathyroid hormone-related peptide (PTHrP). PTH1R is a glycoprotein with seven transmembrane domains and it has an extracellular N-terminus region and an intracellular C-terminus region. The activity of PTH1R is mediated by G proteins which activate adenylyl cyclase. It has been reported that PTHrP and PTH1R are associated with the differentiation of bone and cartilage in the developing stages. PTH1R has several isoforms with 66/59 kDa and PTH1R can form a 120 kDa dimer in the non-reducing condition. With glycosylation modification, the molecular weight of PTH1R will be migrated to 90 kDa (PMID: 16783882). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30762 Product name: Recombinant human PTH1R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-188 aa of BC110388 Sequence: DADDVMTKEEQIFLLHRAQAQCGKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG Predict reactive species Full Name: parathyroid hormone 1 receptor Calculated Molecular Weight: 593 aa, 66 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC110388 Gene Symbol: PTH1R Gene ID (NCBI): 5745 RRID: AB_2918237 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q03431 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924