Proteintech, 29218-1-AP, ALG9 Polyclonal antibody

Size: 20ul / 150ul The ALG9 (29218-1-AP) by Proteintech is a Polyclonal antibody targeting ALG9 in WB, IHC, ELISA applications with reactivity to human samples 29218-1-AP targets ALG9 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, Jurkat cells, THP-1 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ALG9 encodes an endoplasmic reticulum enzyme that builds N-glycans, the third ER protein-encoding polycystic disease gene after GANAB and DNAJB11. Autosomal recessive loss of ALG9 results in a severe congenital disorder of glycosylation (CDG) with a multiorgan phenotype that includes kidney cysts (PMID: 31395617). Western blot analysis detected ALG9 at an apparent molecular mass of 70 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30489 Product name: Recombinant human ALG9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 500-582 aa of BC009255 Sequence: EFRGQLPKPFAEGPLATRIVPTDMNDQNLEEPSRYIDISKCHYLVDLDTMRETPREPKYSSNKEEWISLAYRPFLDASRSSKL Predict reactive species Full Name: asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae) Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC009255 Gene Symbol: ALG9 Gene ID (NCBI): 79796 RRID: AB_3086105 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6U8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.