Proteintech, 29230-1-AP, CLCN7 Polyclonal antibody

Size: 20ul / 150ul The CLCN7 (29230-1-AP) by Proteintech is a Polyclonal antibody targeting CLCN7 in WB, ELISA applications with reactivity to human samples 29230-1-AP targets CLCN7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse kidney tissue, mouse small intestine mouse small intestine, rat small intestine rat small intestine Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The intracellular CLC chloride channel family members ClC-3, ClC-4, and ClC-5 have been proposed as the primary endosomal chloride conductance providers. ClC-7 is expressed in late endosomes and lysosomes, but there is disagreement in the literature regarding its contribution to acidification. More recently, the cystic fibrosis (CF) transmembrane conductance regulator chloride channel (CFTR) was proposed as the specific counter-ion conductance necessary for lysosomal acidification in alveolar macrophages. (PMID: 20566682) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29882 Product name: Recombinant human CLCN7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-126 aa of BC012737 Sequence: MANVSKKVSWSGRDRDDEEAAPLLRRTARPGGGTPLLNGAGPGAARQSPRSALFRVGHMSSVELDDELLDPDMDPPHPFPKEIPHNEKLLSLKYESLDYDNSENQLFLEEERRINHTAFRTVEIKR Predict reactive species Full Name: chloride channel 7 Calculated Molecular Weight: 805 aa, 89 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC012737 Gene Symbol: CLCN7 Gene ID (NCBI): 1186 RRID: AB_3669678 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51798 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.