Product Description
Size: 20ul / 150ul
The CD272/BTLA (29233-1-AP) by Proteintech is a Polyclonal antibody targeting CD272/BTLA in WB, ELISA applications with reactivity to human samples
29233-1-AP targets CD272/BTLA in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Caco-2 cells, SW480 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag30764 Product name: Recombinant human BTLA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-134 aa of BC107091 Sequence: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVT Predict reactive species
Full Name: B and T lymphocyte associated
Calculated Molecular Weight: 289 aa, 33 kDa
Observed Molecular Weight: 40 kDa
GenBank Accession Number: BC107091
Gene Symbol: BTLA
Gene ID (NCBI): 151888
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q7Z6A9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924