Iright
BRAND / VENDOR: Proteintech

Proteintech, 29290-1-AP, NADK Polyclonal antibody

CATALOG NUMBER: 29290-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NADK (29290-1-AP) by Proteintech is a Polyclonal antibody targeting NADK in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29290-1-AP targets NADK in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Hela cells, Neuro-2a cells, NIH/3T3 cells, rat kidney tissue Positive IHC detected in: human ovary cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NAD kinase (NADK) is the sole NADP+-biosynthetic enzyme that catalyzes phosphorylation of NAD+ to yield NADP+ using ATP as a phosphoryl donor, and thus, plays a vital role in the cell and represents a potentially powerful antimicrobial drug target (PMID:21526340). It belongs to the NAD kinase family. NADK has 3 isoforms with the molecular mass of 49, 63 and 46 kDa. The catalytically active human NADK is a homotetramer (PMID:11594753). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30982 Product name: Recombinant human NADK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-446 aa of BC001709 Sequence: SRLKVRVVKELRGKKTAVHNGLGEKGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQCLHWNVRKKQAHFEEEEEEEEEG Predict reactive species Full Name: NAD kinase Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC001709 Gene Symbol: NADK Gene ID (NCBI): 65220 RRID: AB_2918272 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95544 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924