Proteintech, 29313-1-AP, C22orf32 Polyclonal antibody

Size: 20ul / 150ul The C22orf32 (29313-1-AP) by Proteintech is a Polyclonal antibody targeting C22orf32 in WB, IF/ICC, ELISA applications with reactivity to human samples 29313-1-AP targets C22orf32 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SW480 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information C22orf32, also known as SMDT1 or EMRE, is a 10 kDa single-channel transmembrane that contains a mitochondrial targeting sequence, a transmembrane region, and a conserved aspart-rich C-terminal. It acts as a subunit of the MCU complex and increases mCa2+ uptake by activating the MCU function (PMID: 38417574). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29162 Product name: Recombinant human C22orf32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC024237 Sequence: MASGAARWLVLAPVRSGALRSGPSLRKDGDVSAAWSGSGRSLVPSGSVIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD Predict reactive species Full Name: chromosome 22 open reading frame 32 Observed Molecular Weight: 10 kDa GenBank Accession Number: BC024237 Gene Symbol: C22orf32 Gene ID (NCBI): 91689 RRID: AB_3669681 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H4I9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.