Proteintech, 29314-1-AP, METTL3 Polyclonal antibody

Size: 20ul / 150ul The METTL3 (29314-1-AP) by Proteintech is a Polyclonal antibody targeting METTL3 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat, Monkey samples 29314-1-AP targets METTL3 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat, Monkey samples. Tested Applications Positive WB detected in: HeLa cells, Neuro-2a cells, K-562 cells, MCF-7 cells, COS-7 cells, mouse testis tissue, rat testis tissue Positive IHC detected in: human lung cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information METTL3 is a key S-adenosyl-L-methionine-binding subunit, which is a component of a complex multicomponent enzyme that catalyzes the methylation of internal adenosine residues in eukaryotic mRNA, forming N6-methyladenosine. It contains 2 putative nuclear localization signals and 2 consensus methylation motifs. The calculated molecular weight of METTL3 is 64 kDa, but modified METTL3 is about 65-70 kDa. Specification Tested Reactivity: Human, Mouse, Rat, Monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30638 Product name: Recombinant human METTL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 285-485 aa of BC001650 Sequence: MKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLV Predict reactive species Full Name: methyltransferase like 3 Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC001650 Gene Symbol: METTL3 Gene ID (NCBI): 56339 RRID: AB_3086114 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86U44 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.