Proteintech, 29350-1-AP, ABR Polyclonal antibody

Size: 20ul / 150ul The ABR (29350-1-AP) by Proteintech is a Polyclonal antibody targeting ABR in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29350-1-AP targets ABR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, U-251 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information ABR (Active breakpoint cluster region-related protein) is the only protein known in humans and mice to share high homology with BCR (68% amino acid identity). BCR(Breakpoint cluster region) gene was originally identified due to its involvement in a specific chromosomal translocation that causes the development of chronic myeloid leukemia and a subset of acute lymphoblastic leukemia. The C-terminus is a GTPase-activating protein domain which stimulates GTP hydrolysis by RAC1, RAC2 and CDC42. (PMID: 17116687, PMID: 37507586) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29522 Product name: Recombinant human ABR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of NM_021962 Sequence: MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK Predict reactive species Full Name: active BCR-related gene Calculated Molecular Weight: 98 kDa Observed Molecular Weight: 97-100 kDa GenBank Accession Number: NM_021962 Gene Symbol: ABR Gene ID (NCBI): 29 RRID: AB_3086122 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12979 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.