Proteintech, 29353-1-AP, INPP5E Polyclonal antibody

Size: 20ul / 150ul The INPP5E (29353-1-AP) by Proteintech is a Polyclonal antibody targeting INPP5E in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 29353-1-AP targets INPP5E in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse testis tissue, rat testis tissue Positive IF/ICC detected in: ARPE-19 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information INPP5E(72 kDa inositol polyphosphate 5-phosphatase) converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns-P2.In mouse, highest protein expression was in brain, heart, and testis, with lower expression in thymus and lung, and very little expression in kidney, spleen, and liver(PMID:10764818). Defects in INPP5E are the cause of Joubert syndrome type 1 (JBTS1) and mental retardation-truncal obesity-retinal dystrophy-micropenis (MORMS)(PMID:19668215). It has 2 isoforms with the molecular mass of 66 kDa and 70 kDa. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30305 Product name: Recombinant human INPP5E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-350 aa of BC028032 Sequence: RLPSLLPPRPPPALSLDIASDSLRTANKVDSDLADYKLRAQPLLVRAHSSLGPGRPRSPLACDDCSLRSAKSSFSLLAPIRSKDVRSRSYLEGSLLASGALLGADELARYFPDRNVALFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWET Predict reactive species Full Name: inositol polyphosphate-5-phosphatase, 72 kDa Calculated Molecular Weight: 644 aa, 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC028032 Gene Symbol: INPP5E Gene ID (NCBI): 56623 RRID: AB_3086123 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRR6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.