Iright
BRAND / VENDOR: Proteintech

Proteintech, 29362-1-AP, C19orf72 Polyclonal antibody

CATALOG NUMBER: 29362-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C19orf72 (29362-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf72 in WB, ELISA applications with reactivity to human samples 29362-1-AP targets C19orf72 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells, K-562 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information C19orf72, also called DCAF15 (DDB1- and CUL4-associated factor 15), is the substrate-recognition component of the DCX complex, which is a cullin-4-RING E3 ubiquitin-protein ligase complex that mediates ubiquitination and degradation of target proteins (PMID:16949367; 31452512). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30318 Product name: Recombinant human C19orf72 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 226-355 aa of BC013280 Sequence: RSSGSPEPSPAIAKAKEFVADIFRRAKEAKGGVPEEARPALCPGPSGSRCRAHSEPLALCGETAPRDSPPASEAPASEPGYVNYTKLYYVLESGEGTEPEDELEDDKISLPFVVTDLRGRNLRPMRERTA Predict reactive species Full Name: chromosome 19 open reading frame 72 Observed Molecular Weight: 66 kDa GenBank Accession Number: BC013280 Gene Symbol: C19orf72 Gene ID (NCBI): 90379 RRID: AB_3669685 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q66K64 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924