Proteintech, 29365-1-AP, PPP2R5A Polyclonal antibody

Size: 20ul / 150ul The PPP2R5A (29365-1-AP) by Proteintech is a Polyclonal antibody targeting PPP2R5A in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 29365-1-AP targets PPP2R5A in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Protein phosphatase 2, regulatory subunit B (B56), alpha isoform (PPP2R5A) is one of the regulatory subunits of the protein phosphatase 2A (PP2A), which is a major member of protein serine/threonine phosphatases in cells. PPP2R5A can regulate the cellular location, substrate specification and protein phosphatase function of PP2A, through which PPP2R5A plays an important role in many cellular activities. It has been reported that PPP2R5A relates with many diseases including cancers by regulating many crucial signaling pathways involved in P53, Bcl-2, CDK, MAPK, JAK/STAT, c-Myc and β-Catenin. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31072 Product name: Recombinant human PPP2R5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 48-129 aa of BC022474 Sequence: GSQAELHPLPQLKDATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAYSDIVKMISA Predict reactive species Full Name: protein phosphatase 2, regulatory subunit B', alpha isoform Calculated Molecular Weight: 486 aa, 56 kDa Observed Molecular Weight: 50-56 kDa GenBank Accession Number: BC022474 Gene Symbol: PPP2R5A Gene ID (NCBI): 5525 RRID: AB_3086125 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15172 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.