Proteintech, 29397-1-AP, ZHX3 Polyclonal antibody

Size: 20ul / 150ul The ZHX3 (29397-1-AP) by Proteintech is a Polyclonal antibody targeting ZHX3 in WB, ELISA applications with reactivity to Human samples 29397-1-AP targets ZHX3 in WB, IF, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, MCF-7 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information ZHX3 is a member of the zinc fingers and homeoboxes (ZHX) gene family. ZHX3 is a ubiquitous transcriptional repressor expressed in human cells and tissues. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30023 Product name: Recombinant human ZHX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 848-956 aa of NM_015035 Sequence: ELLQDYYMTHKMLYEEDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVHKGMGDTYSEVSENSESWEPRVPEASSEPFDTSSPQAGRQLETD Predict reactive species Full Name: zinc fingers and homeoboxes 3 Calculated Molecular Weight: 105 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: NM_015035 Gene Symbol: ZHX3 Gene ID (NCBI): 23051 RRID: AB_2918292 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H4I2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.