Proteintech, 29424-1-AP, PPP1R3C Polyclonal antibody

Size: 20ul / 150ul The PPP1R3C (29424-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R3C in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29424-1-AP targets PPP1R3C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, mouse cerebellum tissue, rat cerebellum tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information • Protein phosphatase 1 regulatory subunit 3C (PPP1R3C) is an enzyme that binds to protein phosphatase-1 (PP1) as a regulator. The central role of PPP1R3C is associated with glycogenesis and the overexpression of this gene increases glycogen storage. The cellular glycogen level is suppressed when PPP1R3C is knocked-down. PPP1R3C induces glycogen accumulation via HIF1 α during hypoxia and it is hypermethylated in melanoma (PMID: 25846879). Overexpression of PPP1R3C increased hepatic gluconeogenesis in vitro and in vivo while knockdown of PPP1R3C showed an opposite result (PMID: 31181215). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30280 Product name: Recombinant human PPP1R3C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-185 aa of BC012625 Sequence: PYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSALKHHEEKNLILDFPQPSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSFEKKVQ Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 3C Calculated Molecular Weight: 317 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC012625 Gene Symbol: PPP1R3C Gene ID (NCBI): 5507 RRID: AB_2918304 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQK1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.