Iright
BRAND / VENDOR: Proteintech

Proteintech, 29434-1-AP, PSIP1 Polyclonal antibody

CATALOG NUMBER: 29434-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PSIP1 (29434-1-AP) by Proteintech is a Polyclonal antibody targeting PSIP1 in WB, IF/ICC, ELISA applications with reactivity to Human, mouse samples 29434-1-AP targets PSIP1 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, Jurkat cells, NIH/3T3 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PSIP1 enables DNA-binding transcription factor binding activity, chromatin binding activity and transcription coactivator activity. It is involved in mRNA 5'-splice site recognition and positive regulation of transcription by RNA polymerase II. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30640 Product name: Recombinant human PSIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 104-325 aa of NM_021144 Sequence: ASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETE Predict reactive species Full Name: PC4 and SFRS1 interacting protein 1 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: NM_021144 Gene Symbol: PSIP1 Gene ID (NCBI): 11168 RRID: AB_3086132 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75475 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924