Proteintech, 29440-1-AP, Plexin B1 Polyclonal antibody

Size: 20ul / 150ul The Plexin B1 (29440-1-AP) by Proteintech is a Polyclonal antibody targeting Plexin B1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29440-1-AP targets Plexin B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Semaphorins, originally identified as axon guidance molecules, have also been implicated in angiogenesis, immunoregulation, and cancer (PMID: 16584533). Plexins are main receptors for semaphorins and are thought to control many of the functional effects of semaphorins. PLXNB1 is one of the three plexin-B family members. It is a high-affinity receptor for semaphorin 4D (SEMA4D). Interaction of SEMA4D and PLXNB1 has important physiologic effects in the immune and nervous systems, and is also involved in tumor progression, especially in tumor angiogenesis (PMID: 20858260). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31224 Product name: Recombinant human PLXNB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-352 aa of BC146793 Sequence: FLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTE Predict reactive species Full Name: plexin B1 Calculated Molecular Weight: 2135 aa, 232 kDa Observed Molecular Weight: 200-250 kDa GenBank Accession Number: BC146793 Gene Symbol: PLXNB1 Gene ID (NCBI): 5364 RRID: AB_2918306 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43157 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.