Proteintech, 29442-1-AP, SLC4A7/NBCn1 Polyclonal antibody

Size: 20ul / 150ul The SLC4A7/NBCn1 (29442-1-AP) by Proteintech is a Polyclonal antibody targeting SLC4A7/NBCn1 in WB, ELISA applications with reactivity to human samples 29442-1-AP targets SLC4A7/NBCn1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BGC-823 cells, HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information SLC4A7 also known as NBCn1, NBC3, NBC2, is an electroneutral Na(+)/HCO(3)(-) cotransporter (PMID: 14736710). SLC4A7 mediates the coupled movement of sodium and bicarbonate ions across the plasma membrane. SLC4A7 plays a key role in macrophage acidification, mediating bicarbonate import into the cytoplasm which is crucial for net acid extrusion and maintenance of cytoplasmic pH during phagocytosis (PubMed:29779931). SLC4A7 is expressed in testis, spleen, and retina. SLC4A7 may be a major regulator of extracellular pH of retina where light stimulation produces an extracellular alkalization and may contribute as a solute transporter to the prevention of retinal detachment(PMID: 9610397). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30545 Product name: Recombinant human SLC4A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-237 aa of NM_003615 Sequence: LCYRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRASTLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKRFTSRIPLVRSFADI Predict reactive species Full Name: solute carrier family 4, sodium bicarbonate cotransporter, member 7 Calculated Molecular Weight: 136 kDa Observed Molecular Weight: 136 kDa GenBank Accession Number: NM_003615 Gene Symbol: NBCn1/SLC4A7 Gene ID (NCBI): 9497 RRID: AB_3086133 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6M7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.