Iright
BRAND / VENDOR: Proteintech

Proteintech, 29465-1-AP, ERAL1 Polyclonal antibody

CATALOG NUMBER: 29465-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ERAL1 (29465-1-AP) by Proteintech is a Polyclonal antibody targeting ERAL1 in WB, IHC, ELISA applications with reactivity to Human samples 29465-1-AP targets ERAL1 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293T cells, K-562 cells Positive IHC detected in: human colon tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information ERAL1, a homologue of Era protein in Escherichia coli, is a member of conserved GTP-binding proteins with RNA-binding activity. ERAL1 localizes to the mitochondrionmitoribosomal subunit, and binds to the 3' terminal stem loop of 12S mitochondrial rRNA and is required for proper assembly of the 28S small mitochondrial ribosomal subunit. Deletion of ERAL1 has been shown to cause mitochondrial dysfunction, growth retardation, and apoptosis. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30720 Product name: Recombinant human ERAL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-385 aa of BC019094 Sequence: MNKVDCLKQKSVLLELTAALTEGVVNGKKLKMRQAFHSHPGTHCPSPAVKDPNTQSVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQYLLTQAQPGPWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVI Predict reactive species Full Name: Era G-protein-like 1 (E. coli) Calculated Molecular Weight: 437 aa, 48 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC019094 Gene Symbol: ERAL1 Gene ID (NCBI): 26284 RRID: AB_2918311 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75616 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924