Proteintech, 29469-1-AP, VGLUT1 Polyclonal antibody

Size: 20ul / 150ul The VGLUT1 (29469-1-AP) by Proteintech is a Polyclonal antibody targeting VGLUT1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29469-1-AP targets VGLUT1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: unboiled mouse brain tissue, unboiled rat cerebellum tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information Vesicular glutamate transporter 1 (VGLUT1) is a critical protein involved in the packaging and release of the neurotransmitter glutamate in synaptic vesicles. VGLUT1 is predominantly expressed in neurons that release glutamate, the primary excitatory neurotransmitter in the central nervous system, it is a marker of glutamatergic neurons. VGLUT1 has several isoforms with the moleculat weight range from 53-61 kDa.VGLUT1 is a multiple transmembrane protein, which is easily to aggregate if the sample is bolied or treated with high temperature, thus we recommend to use unboiled sample for the detection. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31193 Product name: Recombinant human VGLUT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 500-560 aa of NM_020309 Sequence: PEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY Predict reactive species Full Name: solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: NM_020309 Gene Symbol: VGLUT1 Gene ID (NCBI): 57030 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P2U7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.