Iright
BRAND / VENDOR: Proteintech

Proteintech, 29510-1-AP, RASGRP4 Polyclonal antibody

CATALOG NUMBER: 29510-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RASGRP4 (29510-1-AP) by Proteintech is a Polyclonal antibody targeting RASGRP4 in WB, ELISA applications with reactivity to human samples 29510-1-AP targets RASGRP4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, K-562 cells, Raji cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information RASGRP4 is a member of the RAS guanine nucleotide-releasing protein (RASGRP) family, which are crucial guanine nucleotide exchange factors (GEFs). The primary function of this family is to act as molecular switches that activate RAS signaling pathways by promoting the exchange of GDP for GTP on small GTPases. Specifically, RASGRP4 is highly and preferentially expressed in mast cells. It plays a vital role in the development, maturation, and functional activation of these immune cells by regulating key signaling cascades, such as the MAPK pathway. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31219 Product name: Recombinant human RASGRP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 108-170 aa of BC146669 Sequence: KATGDTQELRRLQICHLVRYWLMRHPEVMHQDPQLEEVIGRFWATVAREGNSAQRRLGDSSDL Predict reactive species Full Name: RAS guanyl releasing protein 4 Calculated Molecular Weight: 673 aa, 75 kDa Observed Molecular Weight: 54-75 kDa GenBank Accession Number: BC146669 Gene Symbol: RASGRP4 Gene ID (NCBI): 115727 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDF6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924