Iright
BRAND / VENDOR: Proteintech

Proteintech, 29516-1-AP, PHF8 Polyclonal antibody

CATALOG NUMBER: 29516-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PHF8 (29516-1-AP) by Proteintech is a Polyclonal antibody targeting PHF8 in WB, IHC, ELISA applications with reactivity to Human samples 29516-1-AP targets PHF8 in WB, IHC, IF, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, Jurkat cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Plant homeodomain finger protein 8 (PHF8) is a JmjC domain-containing protein. PHF8 is localized in the nucleolus and may regulate rRNA transcription. As a member of the KDM7 subfamily of enzymes, PHF8 is involved in demethylation of lysine residues in histones such as H3K27me2/1, H3K9me2/1 and H4K20me1. PHF8 has been reported to participate in cancer development and metastasis of various types of tumors(PMID: 33111613). PHF8 has 5 isoforms produced by alternative splicing(Uniprot). Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30701 Product name: Recombinant human PHF8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 786-948 aa of NM_001184896 Sequence: GQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGTRVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSN Predict reactive species Full Name: PHD finger protein 8 Calculated Molecular Weight: 118 kDa Observed Molecular Weight: 125-135 kDa GenBank Accession Number: NM_001184896 Gene Symbol: PHF8 Gene ID (NCBI): 23133 RRID: AB_2935473 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPP1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924