Iright
BRAND / VENDOR: Proteintech

Proteintech, 29520-1-AP, TM9SF4 Polyclonal antibody

CATALOG NUMBER: 29520-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TM9SF4 (29520-1-AP) by Proteintech is a Polyclonal antibody targeting TM9SF4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 29520-1-AP targets TM9SF4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells, PC-3 cells, mouse kidney tissue Positive IHC detected in: human stomach cancer tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31253 Product name: Recombinant human TM9SF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-210 aa of BC021107 Sequence: EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKADEKSSC Predict reactive species Full Name: transmembrane 9 superfamily protein member 4 Calculated Molecular Weight: 642 aa, 75 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC021107 Gene Symbol: TM9SF4 Gene ID (NCBI): 9777 RRID: AB_3086139 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92544 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924